PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_05707_BGI-A2_v1.0
Common NameF383_03192
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 302aa    MW: 33890.1 Da    PI: 8.9437
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_05707_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.31.9e-31165221158
                   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                 dep+YVN+KQy++Il+RR +Rak+e ++kl  ksrkpylheSRh hA++R RgsgGrF
  Cotton_A_05707_BGI-A2_v1.0 165 DEPIYVNPKQYHGILRRRRHRAKVETRNKL-VKSRKPYLHESRHLHAMNRIRGSGGRF 221
                                 79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-34163224IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.141164224IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.2E-27166221IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.8E-22167189IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.8E-22198221IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MASRVRILPK ENLLISCPPW WNSNEQQFVE IVPQNVSLKK AENRSQLYHN AKRFDLQLLD  60
HEPTLAEAGV TGVNNSQCNS SESGQVESCR KDIEGQTKPV YLLNNPNTLL SPSHPNYNHS  120
MACAQYPYTD AYFTGLFTPY GQQTIAQMTG TAPTRIPLPL DLAEDEPIYV NPKQYHGILR  180
RRRHRAKVET RNKLVKSRKP YLHESRHLHA MNRIRGSGGR FLSKKKPQWS DPTSNYILDI  240
GCLDQKDNNG SELESRCSHT AEYGGSCTSC SNISSITNNG GDISRRAVSS CNGIQNCASL  300
VR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-20165234274NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479120.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
RefseqXP_012479192.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
RefseqXP_012479271.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
RefseqXP_012479343.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
RefseqXP_012479417.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
RefseqXP_012479483.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
TrEMBLA0A0B0NVT90.0A0A0B0NVT9_G
STRINGPOPTR_0006s14740.11e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2438834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.11e-37nuclear factor Y, subunit A5